Genes encode proteins. They do this by carrying information in their sequences. Genes are made up of DNA. This is made up of various combinations of 4 different nucleotides (Adenine (A) Guanine (G) Thymidine (T) and Cytosine (C)). It takes three of these nucleotides (called a codon) to code for one amino acid (proteins are covalently linked amino acid chains). There are two complementary strands of a DNA molecule, and Adenine binds Thymidine on its complementary strand and Guanine binds Cytosine on the complementary strand. Only one strand codes for the protein, and when a sequence is written, it is the coding strand that is presented.
DNA is copied (transcribed) into an RNA message (called messenger RNA – or mRNA) Where the DNA contains a G, the mRNA contains a C; where it contains a C, the mRNA contains a G; where there is a T, the mRNA contains an A. It is basically the same pairings as in DNA – this is how the information is transmitted. The only difference is that RNA does not contain T; another nucleotide called Uracil (U) takes its place. So, where the DNA contains a A, the mRNA contains a U. So, this three letter codon ATG, which encodes the amino acid Methionine, has the complementary DNA sequence TAC on the complementary strand. The mRNA that is transcribed would read AUG (basically identical to the coding strand, but with U replacing T). Transcription is illustrated below, with the complementary DNA strands are in Blue and the RNA is in orange. The top DNA strand is the coding one here and AGC is transcribed into AGC etc . The other DNA strand organises the growing mRNA molecule and is called the template strand.
To make protein (translation), this mRNA binds to a different type of RNA called transfer RNA (tRNA). There are different types of tRNA that bind to different amino acids. They are recruited in the right order by the mRNA trough the same binding rules as before. So, the mRNA sequence that encodes the amino acid Methionine (AUG) will recognise the sequence UAC on the Methionine bound tRNA. In the figure below, the leucine and Alanine specific tRNAs are shown, containing the sequences GAU and CGC respectively. These bind to CUA and CGC on the mRNA, which are encoded by the codons CTA and CGC in the DNA.
DNA is copied (transcribed) into an RNA message (called messenger RNA – or mRNA) Where the DNA contains a G, the mRNA contains a C; where it contains a C, the mRNA contains a G; where there is a T, the mRNA contains an A. It is basically the same pairings as in DNA – this is how the information is transmitted. The only difference is that RNA does not contain T; another nucleotide called Uracil (U) takes its place. So, where the DNA contains a A, the mRNA contains a U. So, this three letter codon ATG, which encodes the amino acid Methionine, has the complementary DNA sequence TAC on the complementary strand. The mRNA that is transcribed would read AUG (basically identical to the coding strand, but with U replacing T). Transcription is illustrated below, with the complementary DNA strands are in Blue and the RNA is in orange. The top DNA strand is the coding one here and AGC is transcribed into AGC etc . The other DNA strand organises the growing mRNA molecule and is called the template strand.
To make protein (translation), this mRNA binds to a different type of RNA called transfer RNA (tRNA). There are different types of tRNA that bind to different amino acids. They are recruited in the right order by the mRNA trough the same binding rules as before. So, the mRNA sequence that encodes the amino acid Methionine (AUG) will recognise the sequence UAC on the Methionine bound tRNA. In the figure below, the leucine and Alanine specific tRNAs are shown, containing the sequences GAU and CGC respectively. These bind to CUA and CGC on the mRNA, which are encoded by the codons CTA and CGC in the DNA.
Different amino acids are encoded by different codons, as shown below. You will also notice that most amino acids have more than one possible codon; some have up to six. this means that there will be one a tRNA for each codon. 
So, Lets take a closer look at this short sequence from the previous post. It is only 42 amino acids long (average proteins contain over 400 amino acids!)
MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQG
Here is the amino acid breakdown and the number of possible codons that can be used in the above sequence..
Another possible place a designer could leave a signature is in the actual genetic code. There is no reason why ATG should have to encode methionine in every species (or indeed why any codon should encode a particular amino acid).
Importantly, it is a different part of the transfer RNA that recognised the mRNA that binds its specific amino acid. It would therefore be possible to mess about and make ATG encode Methionine in one species, but have it encode any other amino acid in another species. Yet, the genetic code is the same across species. Again, this is where evidence of design could be inserted. None is found, so it would appear that if there was a designer, he is unable to write his own name, or just does not want to be found. I'll go with there not being one.
11 comments:
Here is the genetic code for Neds
YOUSEAREAWFUDSYADOBBERSBYTHEWAYAMGONNACHIBYE
At least its one step up from chimps (I think)
So, the number of possible codon strings that could produce the above sequence is (4 x 5 A) x (2 x 3 C) x (2 x 4 D) x…….... (4 x 3 V) = 19 813 556 551 680. Yet human and chimp usage are identical !
So are you saying, I could muck around with the codon strings (19*10^12 different ways?) and it will still behave in the same way?
I’m finding this hard to believe with my ignorance.
If this is correct.... the chances of finding chimps and human amino acid being the same is just crazy and as you said, for 98% of genomes it just gets worse... unless you accept evolution.
Why would God make his supposedly most important creation so closely related to chimps?
(Is God trying to make a monkey out of us... ha ha ha – sorry, very bad joke... I’ll get my coat)
Lee
Lee, it's amazing, isn't it? I had to get someone to check my calculations too. To make matters even worse, the human genome contains about 3.2 billion nucleiotides - the nummber of different possible codon usages must be mind blowing!
Dave,
I met some of the geezabobbulyabam mutants last nigh - pure class!
Hi Billy
To make matters even worse, the human genome contains about 3.2 billion nucleiotides - the nummber of different possible codon usages must be mind blowing!
But could I really muck around with them and have the same results i.e. a working chimp or human?
How would I know? How could this be proven?
I find it hard to believe - but if true, it really does point to evolution rather than creation. Since after all - if God has 12x10^12 different ways or more to plug the amino acid together and it still works - why the hell are they so alike between chimps and humans?
Not only does it not have to be this way... it shouldn't for a perfect most important animal in the universe – we should be unique as the bible and Christians imply.
Lee
Hi Lee,
I'll be doing a post on this some time, but we can swap genes between species and they still work. We can even get the mouse PAX6 gene to get flies to make eyes. Many of us also carry mutations that affect amino acid sequences and there is no ill effect.
We can even get the mouse PAX6 gene to get flies to make eyes.
Flies with mice eyes - cool. Won't they be a little large for them? Mice are much bigger than flies.
Oh... and look forward to the new post - I may get confused by all the letters, but I do enjoy reading this stuff.
Lee
Flies with mice eyes - cool. Won't they be a little large for them? Mice are much bigger than flies.
They actually develop fly eyes. That's the really cool thing. It shows that the fly sequence is not absolute, but genes that encode a very similar protein, but has a slightly different amino acid sequence can do the same job - so neither gene nor protein sequences appear to be an absolute requirement, making phyllogenic constraint the best explanation for the observed sequences.
I know what you mean about sequences (got to look a t a gene sequence later - and turn it upside down and back to front! It help to think in terms of total similarity and differences though for the points I'm making - the absolute sequence is not that important.
Billy
How about creating some flies with mice eyes which could fly around Sauchiehall street shouting SMELLYERMAWGERRITUPYERS and such like. It would certainly cause quite a stir amongst the gentile of the Willow Tea Room
They actually develop fly eyes. That's the really cool thing. It shows that the fly sequence is not absolute
Now it makes sense (though I was really hoping for flies with mice eyes if I tell the truth...)
We can muck about with the sequence (assuming mice and flies are different) and they still work.
Another nail in the coffin for creationism for me - since God could and should have made us more unique.
Lee
Post a Comment